PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 226aa    MW: 24852 Da    PI: 7.1324
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040940genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.1e-19752147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed  l+++v+q+G+++W++I+  ++ gR++k+c++rw + 
      Lus10040940  7 KGSWSPQEDATLIKLVQQHGPRNWSLISTGVP-GRSGKSCRLRWCNQ 52
                     799*****************************.***********985 PP

2Myb_DNA-binding56.46.7e-1861102346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+ Ed l+v+a++++G++ W+tIar ++ gRt++ +k++w++
      Lus10040940  61 PFTPSEDALIVRAHALHGNK-WATIARLLP-GRTDNAIKNHWNS 102
                      89******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.151257IPR017930Myb domain
SuperFamilySSF466891.31E-304100IPR009057Homeodomain-like
SMARTSM007173.2E-16655IPR001005SANT/Myb domain
PfamPF002499.5E-19752IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-25860IPR009057Homeodomain-like
CDDcd001677.91E-15951No hitNo description
SMARTSM007178.0E-1558106IPR001005SANT/Myb domain
PROSITE profilePS5129421.88858108IPR017930Myb domain
CDDcd001672.05E-1261101No hitNo description
Gene3DG3DSA:1.10.10.609.6E-2461107IPR009057Homeodomain-like
PfamPF002492.0E-1561102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MASDRIKGSW SPQEDATLIK LVQQHGPRNW SLISTGVPGR SGKSCRLRWC NQLSPDVQHR  60
PFTPSEDALI VRAHALHGNK WATIARLLPG RTDNAIKNHW NSALRRKRAT EFSESNSAVK  120
RASPLAAESD GESGSGKKMC LRPEEKNTGA SNEYQGEIIG GGPETSLTLS PPGDGIVVTG  180
EEEIKEEEEV EEKGSKWLKG KMEESGLLEI MQRMIAEEVR TYLLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-3861073104MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-38610757158MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-38610757158MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-3861073104C-Myb DNA-Binding Domain
1msf_C2e-3861073104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090668.17e-91PREDICTED: transcriptional activator Myb-like
SwissprotQ9FDW16e-54MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A067LKB37e-91A0A067LKB3_JATCU; MYB family protein
STRINGVIT_13s0067g01360.t011e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-55myb domain protein 73